PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0117000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 336aa    MW: 36320.9 Da    PI: 8.8065
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0117000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-17350148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l d+vk++G g+W+++ r  g+ R++k+c++rw ++l
   Spipo1G0117000  3 KGPWTAAEDAILTDYVKRHGEGNWNAVQRNSGLLRCGKSCRLRWANHL 50
                     79******************************99**********9986 PP

2Myb_DNA-binding51.52.2e-165699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g++++eE+ l+++++++lG++ W++ a+ ++ gRt++++k++w++
   Spipo1G0117000 56 KGPFSPEEERLILELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 99
                     79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.932150IPR017930Myb domain
SuperFamilySSF466894.49E-30297IPR009057Homeodomain-like
SMARTSM007178.7E-14252IPR001005SANT/Myb domain
PfamPF002493.9E-14350IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-23457IPR009057Homeodomain-like
CDDcd001676.09E-11550No hitNo description
PROSITE patternPS0017501827IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129426.04351105IPR017930Myb domain
SMARTSM007174.8E-1655103IPR001005SANT/Myb domain
PfamPF002491.6E-155699IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2658104IPR009057Homeodomain-like
CDDcd001672.19E-125899No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MKKGPWTAAE DAILTDYVKR HGEGNWNAVQ RNSGLLRCGK SCRLRWANHL RPNLRKGPFS  60
PEEERLILEL HAKLGNKWAR MAAQLPGRTD NEIKNYWNTR IKRRQRAGLP LYPLDIQRQA  120
ALHHHHRPSA GAAPLSFLDR AELGVAPTAG TSSLMVNPGH CLSFIVPSPA GETGLQQRGG  180
AFPDDGVGGF SMAFSSNTVA PPPSQNAVFL LNALGLYELS SPSPQHHRQS FSVKMEPPSS  240
QFFPEVPTRR SESDLLDSLL FDGAAVMDGG GSADKCGNVG GDHRRGHNFL PEPTAENFSY  300
VNENAGGGNS QGLVLGDCGG KWDYSKLPLS LPGTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3031047107B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.12e-72myb domain protein 101